PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00091.1.g01510.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 805aa    MW: 88655.5 Da    PI: 10.0662
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00091.1.g01510.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.29e-29542595255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   +r+rWt eLH+rFv av++LGG++kAtPk++l++m+v gLtl+h+kS LQkYR+
  Zjn_sc00091.1.g01510.1.am.mk 542 QRVRWTRELHRRFVLAVSELGGADKATPKAVLRVMDVRGLTLHHLKSYLQKYRM 595
                                   7****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.4E-14540598IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-28541599IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-21542595IPR006447Myb domain, plants
PfamPF002491.4E-5543594IPR001005SANT/Myb domain
PfamPF143793.1E-14657694IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 805 aa     Download sequence    Send to blast
MTPSTTGSCR GRGVGLLGGE EASPPPSYGP HGLSMRFLAR GMAGRGGGRG SGGCVRVRVS  60
PVLPVEGRRR SSTLSPSLSR KRRQPRSEVK PLPPTQTISF VLKQSSSEKS VRAEIDRCCD  120
RLSSERFICF RVSRACNDAV AVPGEGKGGA GAEQSRFTTA GQTHRNSSCG CPYYPGTSPP  180
RFPRFPRPRT HPHPHPHPLS FLMTPLPKTK QSGRQAQGSD EHAKDADTTV SVRPSHVNHE  240
MPGTNDCELR DKRRLVISSQ NASEARRGPG YSSATTRNGN SVGMWRLETE STAMKRPLTR  300
TDEYDRRSGR WRLSLTAHRS LVTPPQQQRR PKHTRVRARR WTEASFAIHA DSYVRGRGGR  360
GQFANCVRAQ LLLVPAGLCV VVAVLVKGVK AKGGNNGGCK RRCMAHWHGP QLPRHRYSLP  420
FPPCRAYPYI YQRRRSRTHS TEEEYICAVE SKATNLLSAQ PVSNSQLAAY KTAPRHHRLL  480
GTCFCCCRWS SLQLRPSRRA SHAGQAADAA TPRDVVLGTL EMSSSGGCYA GQSGGEPAGR  540
PQRVRWTREL HRRFVLAVSE LGGADKATPK AVLRVMDVRG LTLHHLKSYL QKYRMAVSRG  600
LVEVTDDNGE GQNDRSSSSE NQPDEYDEDT VTEMYRTFAN DESEVLCDSS RSVTWIQREV  660
HRNLQEQIEV QRHLQLRIEA QGRYLQSVLR RAEEVLADYS LDLPEAELSE LVSAAASTSS  720
SLSLSPLHYP STASCVTSSS SSEAESKASA KRLCACADMR ECTVEQPVQS KRGVLQSNRR  780
QQGDADEAEA EADAENGSSG IDLNR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13949RGMAGRGGGRG
26782RRRSSTLSPSLSRKRR
37883SRKRRQ
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112643038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.27e-37G2-like family protein